Record in detail


General Info

  • lamp_id:L06AT00243
  • Name:O65066_PICMA
  • FullName:
  • Source:Picea mariana
  • Mass:7283.5 Da
  • Sequence Length:66 aa
  • Isoelectric Point:8.83
  • Activity:Antimicrobial
  • Sequence
        GSLRPSECGQRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTQQGGPKCP
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000863    From 10 To 75 E-value: 8e-34 Score: 134
        GSLRPSECGQRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTQQGGPKCP
  • 2. L06AT00243    From 1 To 66 E-value: 1e-33 Score: 133
        GSLRPSECGQRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTQQGGPKCP
  • 3. L06AT00245    From 1 To 66 E-value: 2e-31 Score: 125
        GRLHPSECGGRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP
  • 4. L01A000882    From 32 To 97 E-value: 1e-30 Score: 123
        GTLRPSDCKPKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQICPCYNSWKTKEGGPKCP
  • 5. L06AT00252    From 2 To 67 E-value: 1e-26 Score: 110
        NKLRPTDCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP

Structure

  •   Domains
  •   1  Name:GASA    Interpro Link:IPR003854
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bousquet J.,Perry D.J.,
  •   Title:Sequence-tagged-site (STS) markers of arbitrary genes: development, characterization and analysis of linkage in black spruce.
  •   Journal:Genetics, 1998, 149, 1089-1098  [MEDLINE:98278823]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: