Record in detail


General Info

  • lamp_id:L06AT00247
  • Name:GASA6_ARATH
  • FullName:Gibberellin-regulated protein 6
  • Source:Arabidopsis thaliana
  • Mass:7363.6 Da
  • Sequence Length:66 aa
  • Isoelectric Point:8.96
  • Activity:Antimicrobial
  • Sequence
        GSLKSYQCGGQCTRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP
  • Function:Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00247    From 1 To 66 E-value: 2e-33 Score: 132
        GSLKSYQCGGQCTRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP
  • 2. L01A000878    From 1 To 63 E-value: 1e-31 Score: 126
        KSYQCGGQCTRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP
  • 3. L06AT00241    From 1 To 66 E-value: 4e-28 Score: 115
        GSLKSSQCNPECTRRCSKTQYHKPCMFFCQKCCRKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP
  • 4. L06AT00245    From 1 To 66 E-value: 9e-27 Score: 110
        GRLHPSECGGRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP
  • 5. L01A000863    From 10 To 75 E-value: 1e-26 Score: 110
        GSLRPSECGQRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTQQGGPKCP

Structure

  •   Domains
  •   1  Name:GASA    Interpro Link:IPR003854
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kaul S.,Federspiel N.A.,Palm C.J.,Ecker J.R.,Theologis A.,
  •   Title:Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 2000, 408, 816-820  [MEDLINE:21016719]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: