Record in detail


General Info

  • lamp_id:L06AT00252
  • Name:RSI1_SOLLC
  • FullName:Protein RSI-1
  • Source:Solanum lycopersicum
  • Mass:7677 Da
  • Sequence Length:67 aa
  • Isoelectric Point:9.12
  • Activity:Antimicrobial
  • Sequence
        YNKLRPTDCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00252    From 1 To 67 E-value: 3e-34 Score: 135
        YNKLRPTDCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP
  • 2. L01A000877    From 1 To 64 E-value: 1e-32 Score: 129
        LRPTDCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP
  • 3. L01A000882    From 34 To 97 E-value: 3e-29 Score: 118
        LRPSDCKPKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQICPCYNSWKTKEGGPKCP
  • 4. L01A000863    From 10 To 75 E-value: 5e-27 Score: 111
        GSLRPSECGQRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTQQGGPKCP
  • 5. L06AT00243    From 1 To 66 E-value: 1e-26 Score: 110
        GSLRPSECGQRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTQQGGPKCP

Structure

  •   Domains
  •   1  Name:GASA    Interpro Link:IPR003854
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Scheuring C.F.,Taylor B.H.,
  •   Title:A molecular marker for lateral root initiation: the RSI-1 gene of tomato (Lycopersicon esculentum Mill) is activated in early lateral root primordia.
  •   Journal:Mol. Gen. Genet., 1994, 243, 148-157  [MEDLINE:94232181]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: