Record in detail


General Info

  • lamp_id:L07APD0027
  • Name:CECA_HYACE
  • FullName:Cecropin-A
  • Source:Hyalophora cecropia
  • Mass:4061.9 Da
  • Sequence Length:38 aa
  • Isoelectric Point:11.18
  • Activity:Antimicrobial
  • Sequence
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKG
  • Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000212    From 27 To 64 E-value: 3e-16 Score: 75.9
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKG
  • 2. L07APD0027    From 1 To 38 E-value: 9e-16 Score: 73.9
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKG
  • 3. L01A000062    From 1 To 37 E-value: 0.000000000000003 Score: 72
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
  • 4. L11A010351    From 1 To 38 E-value: 0.00000000000001 Score: 70.1
        KWKFFKKIERVGQNIRDGIIKAGPAVAVVGQATNIAKG
  • 5. L11A002257    From 1 To 37 E-value: 0.00000000000002 Score: 69.3
        KWKLFKKIEKVGQNIRDGIIKAGPAVAWVGQATQIAK

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Boman H.G.,Bennich H.,Engstroem A.,Hultmark D.,Steiner H.,
  •   Title:Sequence and specificity of two antibacterial proteins involved in insect immunity.
  •   Journal:Nature, 1981, 292, 246-248  [MEDLINE:81245158]
  •   [2]  Boman H.G.,Kapur R.,Bennich H.,Engstroem A.,Hultmark D.,
  •   Title:Insect immunity: isolation and structure of cecropin D and four minor antibacterial components from Cecropia pupae.
  •   Journal:Eur. J. Biochem., 1982, 127, 207-217  [MEDLINE:83053366]
  •   [3]  Boman H.G.,Xanthopoulos K.G.,Gudmundsson G.H.,Lidholm D.-A.,
  •   Title:Insect immunity: cDNA clones coding for the precursor forms of cecropins A and D, antibacterial proteins from Hyalophora cecropia.
  •   Journal:FEBS Lett., 1987, 226, 8-12  [:]
  •   [4]  Bennich H.,Lindeberg G.,Kraulis P.J.,Engstroem A.,Holak T.A.,
  •   Title:The solution conformation of the antibacterial peptide cecropin A: a nuclear magnetic resonance and dynamical simulated annealing study.
  •   Journal:Biochemistry, 1988, 27, 7620-7629  [MEDLINE:89088132]
  •   [5]  Boman H.G.,Gan R.,Aasling B.,Lidholm D.-A.,Gudmundsson G.H.,
  •   Title:The cecropin locus. Cloning and expression of a gene cluster encoding three antibacterial peptides in Hyalophora cecropia.
  •   Journal:J. Biol. Chem., 1991, 266, 11510-11517  [MEDLINE:91268009]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: