Record in detail


General Info

  • lamp_id:L07APD0045
  • Name:Q7Z286_FENCH
  • FullName:
  • Source:Fenneropenaeus chinensis
  • Mass:5461.2 Da
  • Sequence Length:51 aa
  • Isoelectric Point:9.77
  • Activity:Antimicrobial
  • Sequence
        KGGYTRPISRPPYGGGYGNVCTSCHVLTTSQARSCCSRFGRCCVPRRGYSG
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09133|    From 21 To 71 E-value: 2e-24 Score: 102
        KGGYTRPISRPPYGGGYGNVCTSCHVLTTSQARSCCSRFGRCCVPRRGYSG
  • 2. L12A09134|    From 21 To 71 E-value: 5e-24 Score: 101
        KSGYTRPISRPPYGGGYGNVCTSCHVLTTSQARSCCSRFGRCCVPRRGYSG
  • 3. L07APD0045    From 1 To 51 E-value: 6e-24 Score: 101
        KGGYTRPISRPPYGGGYGNVCTSCHVLTTSQARSCCSRFGRCCVPRRGYSG
  • 4. L12A09110|    From 23 To 73 E-value: 0.000000000004 Score: 61.6
        QGGYTRPFPRPPYGGGYHPVPVCTSCHRLSPLQARACCRQLGRCCDAKQTY
  • 5. L12A09154|    From 23 To 70 E-value: 0.000000000007 Score: 60.8
        QGGYTRPFSRPSYGGGYVSRPGTVCASCPVLSSPQARSCCRQLGRCCV

Structure

  •   Domains
  •   1  Name:Penaeidin    Interpro Link:IPR009226
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Xiang J.-H.,Zhao X.-F.,Wang J.-X.,Kang C.-J.,
  •   Title:Molecular cloning of the cDNA encoding a mature antimicrobial peptide from Chinese shrimp: Fenneropenaeus chinensis.
  •   Journal:Shandong Da Xue Xue Bao Li Xue Ban, 2002, 37, 554-559  [:]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: