Record in detail


General Info

  • lamp_id:L07APD0048
  • Name:DEFB1_HUMAN
  • FullName:Beta-defensin 1
  • Source:Homo sapiens
  • Mass:4221 Da
  • Sequence Length:39 aa
  • Isoelectric Point:9.19
  • Activity:Antimicrobial
  • Sequence
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPN
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L07APD0048    From 1 To 39 E-value: 6e-18 Score: 81.3
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPN
  • 2. L01A001370    From 27 To 64 E-value: 9e-18 Score: 80.5
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • 3. L01A001369    From 27 To 64 E-value: 1e-17 Score: 80.5
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • 4. L01A003038    From 4 To 41 E-value: 3e-17 Score: 79
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • 5. L01A000522    From 4 To 41 E-value: 3e-17 Score: 78.6
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: