Record in detail


General Info

  • lamp_id:L07APD0081
  • Name:GLL9_CHICK
  • FullName:Gallinacin-9
  • Source:Gallus gallus
  • Mass:4359 Da
  • Sequence Length:42 aa
  • Isoelectric Point:8.64
  • Activity:Antimicrobial
  • Sequence
        ADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • Function:Has bactericidal activity. Potent activity against C.jejuni, C.perfringens, S.aureus, C.albicans and S.cerevisiae. Less potent against S.typhimurium and E.coli.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF298    From 26 To 67 E-value: 3e-20 Score: 89
        ADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • 2. L07APD0081    From 1 To 42 E-value: 2e-19 Score: 86.3
        ADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • 3. L12A09035|    From 27 To 67 E-value: 3e-19 Score: 85.1
        DTLACRQGHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • 4. L02A001146    From 1 To 41 E-value: 5e-19 Score: 84.7
        DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • 5. L02A001548    From 1 To 42 E-value: 8e-19 Score: 84
        ADTLACRQSHQSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
  •   Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
  •   Journal:BMC Genomics, 2004, 5, 56-56  [PubMed:15310403]
  •   [2]  James T.,Tierney J.,Gaines S.,Higgs R.,Lynn D.J.,
  •   Title:Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.
  •   Journal:Immunogenetics, 2004, 56, 170-177  [PubMed:15148642]
  •   [3]  Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
  •   Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
  •   Journal:Reproduction, 2007, 133, 127-133  [PubMed:17244739]
  •   [4]  Romijn R.A.,Tjeerdsma-van Bokhoven J.L.M.,Kalkhove S.I.C.,Veldhuizen E.J.A.,van Dijk A.,
  •   Title:The beta-defensin gallinacin-6 is expressed in the chicken digestive tract and has antimicrobial activity against food-borne pathogens.
  •   Journal:Antimicrob. Agents Chemother., 2007, 51, 912-922  [PubMed:17194828]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: