Record in detail


General Info

  • lamp_id:L07APD0132
  • Name:SCAS_MESMA
  • FullName:Beta-toxin BmKAS
  • Source:Mesobuthus martensii
  • Mass:7701.7 Da
  • Sequence Length:66 aa
  • Isoelectric Point:8.38
  • Activity:Antimicrobial
  • Sequence
        DNGYLLDKYTGCKVWCVINNESCNSECKIRGGYYGYCYFWKLACFCQGARKSELWNYNTNKCNGKL
  • Function:Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. It binds to distinct receptor sites of mammal and insect voltage-gated sodium channels. It displays antinociceptive effect in rat models, which is due to its specific modulation of sodium channels of sensory neurons. It also significantly stimulates the binding of [3H]-ryanodine to ryanodine receptors on the sarcoplasmic reticulum of the skeletal muscle through an indirect mechanism. And it promotes noradrenaline release from the rat hippocampus slice.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L07APD0132    From 1 To 66 E-value: 1e-33 Score: 133
        DNGYLLDKYTGCKVWCVINNESCNSECKIRGGYYGYCYFWKLACFCQGARKSELWNYNTNKCNGKL
  • 2. L11A011327    From 1 To 66 E-value: 2e-30 Score: 122
        EHGYLLDKYTGCKVWCVINNESCNGECKRRGGYYGYCYFWKLACFCQGARKSELWHYETNKCNGRM
  • 3. L12A01148|    From 1 To 66 E-value: 3e-29 Score: 119
        DNGYLLDKYTGCKVWCVINNESCNSECKIRRGNYGYCYFWKLACYCEGAPKSELWHYETNKCNGRM
  • 4. L13A017036    From 1 To 49 E-value: 1e-21 Score: 93.2
        DNGYLLDKYTGCKVWCVINNESCNSECKIRRGNYGYCYFWKLACYCEGA
  • 5. L11A011326    From 1 To 64 E-value: 2e-20 Score: 89.7
        DNGYLLDKYTGCKIWCVINNDSCNSHCIGSGGYYGYCYFWKLACYCQGAPRSELWHYETNRCRA

Structure

  •   Domains
  •   1  Name:Knot1    Interpro Link:IPR003614
  •   2  Name:Scorpion_toxinL    Interpro Link:IPR018218
  •   3  Name:Scorpion_toxinL/defesin    Interpro Link:IPR002061
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hoshino M.,Liu Y.,Zhou C.-W.,Huang H.-Y.,Ji Y.-H.,
  •   Title:BmK AS, an active scorpion polypeptide, enhance [3H]-noradrenaline release from rat hippocampal slices.
  •   Journal:Biomed. Res., 1997, 18, 257-260  [:]
  •   [2]  Xu K.,Ji Y.-H.,Hirayama Y.,Kawano S.,Kuniyasu A.,
  •   Title:A new scorpion toxin (BmK-PL) stimulates Ca2+-release channel activity of the skeletal-muscle ryanodine receptor by an indirect mechanism.
  •   Journal:Biochem. J., 1999, 339, 343-350  [PubMed:10191265]
  •   [3]  Yamaki T.,Song B.-L.,Zhang J.-W.,Li Y.-J.,Ji Y.-H.,
  •   Title:Covalent structures of BmK AS and BmK AS-1, two novel bioactive polypeptides purified from Chinese scorpion Buthus martensi Karsch.
  •   Journal:Toxicon, 1999, 37, 519-536  [MEDLINE:99178440]
  •   [4]  Xu K.,Feng J.-C.,Zhuo X.-L.,Dai L.,Lan Z.-D.,
  •   Title:Gene cloning and sequencing of BmK AS and BmK AS-1, two novel neurotoxins from the scorpion Buthus martensi Karsch.
  •   Journal:Toxicon, 1999, 37, 815-823  [MEDLINE:99235397]
  •   [5]  Ji Y.-H.,Liu Y.,Li Y.-J.,
  •   Title:BmK AS: new scorpion neurotoxin binds to distinct receptor sites of mammal and insect voltage-gated sodium channels.
  •   Journal:J. Neurosci. Res., 2000, 61, 541-548  [PubMed:10956424]
  •   [6]  Ji Y.-H.,Chen B.,
  •   Title:Antihyperalgesia effect of BmK AS, a scorpion toxin, in rat by intraplantar injection.
  •   Journal:Brain Res., 2002, 952, 322-326  [PubMed:12376194]
  •   [7]  Ji Y.-H.,Feng X.-H.,Shun H.-Y.,Chen J.,Tan Z.-Y.,
  •   Title:Modulation of BmK AS, a scorpion neurotoxic polypeptide, on voltage-gated Na+ channels in B104 neuronal cell line.
  •   Journal:Neurosci. Lett., 2003, 340, 123-126  [PubMed:12668252]
  •   [8]  Ji Y.-H.,Susumu T.,Feng X.-H.,Chen J.,Tan Z.-Y.,
  •   Title:Modulation of intracellular Na+ concentration by BmK AS, a scorpion toxin, in B104 cell line.
  •   Journal:NeuroReport, 2004, 15, 13-16  [PubMed:15106823]
  •   [9]  Bai Z.-T.,Tan Z.-Y.,Shi J.,Feng X.-H.,Chen J.,
  •   Title:The anti-nociceptive effect of BmK AS, a scorpion active polypeptide, and the possible mechanism on specifically modulating voltage-gated Na+ currents in primary afferent neurons.
  •   Journal:Peptides, 2006, 27, 2182-2192  [PubMed:16716457]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: