Record in detail


General Info

  • lamp_id:L07APD0151
  • Name:Q68KS5_PIERA
  • FullName:
  • Source:Pieris rapae
  • Mass:4137.9 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.84
  • Activity:Antimicrobial
  • Sequence
        KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYK
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L07APD0151    From 1 To 37 E-value: 1e-16 Score: 76.6
        KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYK
  • 2. L01A002780    From 1 To 37 E-value: 2e-16 Score: 76.3
        KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYK
  • 3. L07APD0178    From 1 To 37 E-value: 2e-16 Score: 76.3
        KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYK
  • 4. L11A013148    From 1 To 37 E-value: 0.00000000000002 Score: 68.9
        KWKFFKKIERVGQNIRDGIIKAGPAVQVVGQAATIYK
  • 5. L11A009208    From 1 To 37 E-value: 0.0000000000003 Score: 65.9
        KWKIFKKIEKAGRNIRDGIIKAGPAVSVVGEAATIYK

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bang I.S.,Han S.S.,Kang C.S.,Yoe S.M.,
  •   Title:Characterization and cDNA cloning of hinnavin II, a cecropin family antibacterial peptide from the cabbage butterfly, Artogeia rapae.
  •   Journal:Comp. Biochem. Physiol. B, Biochem. Mol. Biol., 2006, 144, 199-205  [PubMed:16616565]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: