Record in detail


General Info

  • lamp_id:L07APD0170
  • Name:B6VEV8_VIGUN
  • FullName:
  • Source:Vigna unguiculata
  • Mass:5413 Da
  • Sequence Length:47 aa
  • Isoelectric Point:7.67
  • Activity:Antimicrobial
  • Sequence
        KTCENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000109    From 29 To 75 E-value: 1e-23 Score: 100
        KTCENLVDTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC
  • 2. L07APD0170    From 1 To 47 E-value: 6e-23 Score: 97.8
        KTCENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC
  • 3. L02A000919    From 1 To 47 E-value: 2e-22 Score: 96.3
        KTCENLVDTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC
  • 4. L05ADEF409    From 29 To 75 E-value: 3e-22 Score: 95.1
        KTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC
  • 5. L11A002570    From 29 To 75 E-value: 5e-22 Score: 94.7
        KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Franco O.L.,Anderson M.A.,Murad A.M.,Lay F.T.,Pelegrini P.B.,
  •   Title:Novel insights on the mechanism of action of alpha-amylase inhibitors from the plant defensin family.
  •   Journal:Proteins, 2008, 73, 719-729  [PubMed:18498107]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: