Record in detail
General Info
- lamp_id:L07APD0176
- Name:TRFL_CAPHI
- FullName:Lactotransferrin
- Source:Capra hircus
- Mass:4934.8 Da
- Sequence Length:41 aa
- Isoelectric Point:11.84
- Activity:Antimicrobial
- Sequence
APRKNVRWCAISLPEWSKCYQWQRRMRKLGAPSITCIRRTS - Function:Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate.
Cross-Linking
- Cross-linking
- 1 Database:dbAMP dbAMP_00473
- 2 Database:DRAMP DRAMP03676
- 3 Database:Uniprot Q29477
- 4 Database:RAP RAPD0176
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L07APD0176 From 1 To 41 E-value: 4e-19 Score: 85.1
APRKNVRWCAISLPEWSKCYQWQRRMRKLGAPSITCIRRTS - 2. L12A05622| From 5 To 44 E-value: 0.00000000000007 Score: 67.8
APRKNVRWCTISQPEWLKCHRWQWRMKKLGAPSITCVRRA - 3. L07APD0091 From 6 To 45 E-value: 0.0000000000002 Score: 65.9
APRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRA - 4. L12A05621| From 5 To 44 E-value: 0.0000000000002 Score: 65.9
APRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRA - 5. L12A03254| From 6 To 45 E-value: 0.0000000000002 Score: 65.9
APRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRA
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Martin P.,Guerin G.,Nocart M.,le Provost F.,
- Title:Characterization of the goat lactoferrin cDNA. Assignment of the relevant locus to bovine U12 synteny group.
- Journal:Biochem. Biophys. Res. Commun., 1994, 203, 1324-1332 [MEDLINE:94380047]
Comments
- Comments
No comments found on LAMP database