Record in detail


General Info

  • lamp_id:L11A000053
  • Name:Beta-defensin 14 [C11,18,23,33,41A], mBD-14 [C11,18,23,33,41A]
  • FullName:
  • Source:
  • Mass:5029.9 Da
  • Sequence Length:45 aa
  • Isoelectric Point:12.42
  • Activity:Gram+Gram-
  • Sequence
        FLPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  53

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A000053    From 1 To 45 E-value: 4e-20 Score: 88.2
        FLPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • 2. L11A001150    From 1 To 44 E-value: 2e-19 Score: 85.9
        LPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • 3. L11A006085    From 1 To 45 E-value: 3e-19 Score: 85.5
        FLPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKAARKKK
  • 4. L11A001152    From 1 To 43 E-value: 7e-19 Score: 84.3
        PKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • 5. L01A002474    From 1 To 45 E-value: 2e-18 Score: 82.8
        FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Reynolds nL, De Cecco M, Taylor K, Stanton C, Kilanowski F, Kalapothakis J, Seo E, Uhrin D, Campopia
  •   Title:Peptide fragments of a beta-defensin derivative with potent bactericidal activity
  •   Journal:Antimicrob Agents Chemother, 2010, 54, 1922-1929  [:20176896]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: