Record in detail


General Info

  • lamp_id:L11A001109
  • Name:Lantibiotic Geobacillin I
  • FullName:
  • Source: Geobacillus thermodenitrificans
  • Mass:2777.2 Da
  • Sequence Length:33 aa
  • Isoelectric Point:11.66
  • Activity:Gram+
  • Sequence
        VXxKXLXxPGXIxGVLMXLxQNxXVxXNxXIRX
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1109

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001971    From 1 To 32 E-value: 0.0003 Score: 35.8
        VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIR
  • 2. L12A06271|    From 24 To 55 E-value: 0.0005 Score: 35
        VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIR
  • 3. L12A06281|    From 24 To 55 E-value: 0.001 Score: 33.5
        ITSKSLCTPGCITGILMCLTQNSCVSCNSCIR
  • 4. L12A07404|    From 24 To 55 E-value: 0.015 Score: 30
        ITSKSLCTPGCITGVLMCITQNSCVSCKSCIK
  • 5. L11A001109    From 1 To 32 E-value: 0.052 Score: 28.1
        VXXKXLXXPGXIXGVLMXLXQNXXVXXNXXIR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Garg n, Tang W, Goto Y, nair SK, van der Donk WA
  •   Title:Lantibiotics from Geobacillus thermodenitrificans
  •   Journal:Proc natl Acad Sci U S A, 2012, 109, 5241-5246  [:22431611]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: