Record in detail


General Info

  • lamp_id:L11A001152
  • Name:Beta-defensin 14 (3-45)[C,16,21,31,39A], mBD-14 (3-45)[C9,16,21,31,39A]
  • FullName:
  • Source:
  • Mass:4769.6 Da
  • Sequence Length:43 aa
  • Isoelectric Point:12.42
  • Activity:Gram+Gram-
  • Sequence
        PKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1152

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A001150    From 2 To 44 E-value: 7e-19 Score: 84.3
        PKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • 2. L11A001152    From 1 To 43 E-value: 7e-19 Score: 84.3
        PKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • 3. L11A000053    From 3 To 45 E-value: 7e-19 Score: 84.3
        PKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • 4. L11A006085    From 3 To 45 E-value: 5e-18 Score: 81.3
        PKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKAARKKK
  • 5. L01A002474    From 3 To 45 E-value: 3e-17 Score: 78.6
        PKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Reynolds nL, De Cecco M, Taylor K, Stanton C, Kilanowski F, Kalapothakis J, Seo E, Uhrin D, Campopia
  •   Title:Peptide fragments of a beta-defensin derivative with potent bactericidal activity
  •   Journal:Antimicrob Agents Chemother, 2010, 54, 1922-1929  [:20176896]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: