Record in detail


General Info

  • lamp_id:L11A001186
  • Name:Bacteriocin Carnobacteriocin B1
  • FullName:
  • Source: Carnobacterium maltaromaticum
  • Mass:4453 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.76
  • Activity:Gram+Gram-
  • Sequence
        AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGXGH
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1186

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08227|    From 19 To 61 E-value: 2e-19 Score: 86.3
        AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH
  • 2. L01A000573    From 1 To 43 E-value: 4e-19 Score: 85.1
        AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH
  • 3. L11A001186    From 1 To 43 E-value: 5e-19 Score: 84.7
        AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGXGH
  • 4. L12A02699|    From 15 To 55 E-value: 0.0000000000004 Score: 65.1
        SYGNGVYCNKQKCWVNWNEAKQQIAGIVIGGWASSLASMGR
  • 5. L12A09063|    From 31 To 71 E-value: 0.000000000003 Score: 62.4
        SYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Quadri LE, Sailer M, Roy KL, Vederas JC, Stiles ME
  •   Title:Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV17B
  •   Journal:J Biol Chem, 1994, 269, 12204-12211  [:8163526]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: