Record in detail


General Info

  • lamp_id:L11A001642
  • Name:Antimicrobial peptide 1, MJ-AMP1, AMP1
  • FullName:
  • Source: Mirabilis jalapa
  • Mass:3929.4 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.38
  • Activity:Gram+Gram-FungusMammalian Cell
  • Sequence
        XCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1642

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000073    From 26 To 61 E-value: 1e-16 Score: 77
        CIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • 2. L01A000208    From 2 To 37 E-value: 0.000000000000001 Score: 73.2
        CIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • 3. L11A001642    From 2 To 37 E-value: 0.000000000000002 Score: 73.2
        CIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • 4. L03A000097    From 28 To 63 E-value: 0.000000000000003 Score: 72
        CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR
  • 5. L01A000209    From 1 To 36 E-value: 0.00000000000005 Score: 68.2
        CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cammue BP, De Bolle MF, Terras FR, Proost P, Van Damme J, Rees SB, Vanderleyden J, Broekaert WF
  •   Title:Isolation and characterization of a novel class of plant antimicrobial peptides form Mirabilis jalapa L
  •   Journal:J Biol Chem, 1992, 267, 2228-2233  [:1733929]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: