Record in detail


General Info

  • lamp_id:L11A001773
  • Name:Leaf cyclotide, Vhl-1
  • FullName:
  • Source: Viola hederacea
  • Mass:3266.8 Da
  • Sequence Length:31 aa
  • Isoelectric Point:6.04
  • Activity:Gram+Gram-VirusFungus
  • Sequence
        CGESCAXISFCFTEVIGCSCKNKVCYLNSIS
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1773

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002720    From 1 To 31 E-value: 0.00000000001 Score: 60.1
        CGESCAMISFCFTEVIGCSCKNKVCYLNSIS
  • 2. L11A001773    From 1 To 31 E-value: 0.00000000002 Score: 59.3
        CGESCAXISFCFTEVIGCSCKNKVCYLNSIS
  • 3. L06AT00206    From 4 To 31 E-value: 0.0000000003 Score: 55.8
        CGESCAMISFCFTEVIGCSCKNKVCYLN
  • 4. L02A001092    From 4 To 30 E-value: 0.000007 Score: 41.2
        CGESCVYIP-CFTAVVGCTCKDKVCYLN
  • 5. L12A05610|    From 65 To 93 E-value: 0.000009 Score: 40.8
        CGESCVFIP-CISSVLGCSCKNKVCYRNSL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chen B, Colgrave ML, Daly nL, Rosengren KJ, Gustafson KR, Craik DJ
  •   Title:Isolation and characterization of novel cyclotides from Viola hederaceae: solution structure and anti-HIV activity of vhl-1, a leaf-specific expressed cyclotide
  •   Journal:J Biol Chem, 2005, 280, 22395-22405  [:15824119]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: