Record in detail


General Info

  • lamp_id:L11A001926
  • Name:Defensin-like protein / 2 Rs-AFP2
  • FullName:
  • Source: Raphanus sativus
  • Mass:5664.5 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.79
  • Activity:Gram+Gram-Fungus
  • Sequence
        XKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1926

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000092    From 31 To 80 E-value: 1e-26 Score: 109
        KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
  • 2. L01A002125    From 31 To 80 E-value: 1e-25 Score: 106
        KLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
  • 3. L12A06263|    From 31 To 80 E-value: 1e-25 Score: 106
        KLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
  • 4. L01A002029    From 2 To 51 E-value: 2e-25 Score: 105
        KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
  • 5. L11A001926    From 2 To 51 E-value: 2e-25 Score: 105
        KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees S
  •   Title:Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae
  •   Journal:FEBS Lett, 1995, 368, 257-262  [:7628617]
  •   [2]  Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF
  •   Title:A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species
  •   Journal:FEBS Lett, 1993, 316, 233-240  [:8422949]
  •   [3]  Terras FR, Schoofs HM, De Bolle MF, Van Leuven F, Rees SB, Vanderleyden J, Cammue BP, Broekaert WF
  •   Title:Analysis of two novel classes of plant antifungal proteins from radish (Raphanus sativus L
  •   Journal:J Biol Chem, 1992, 267, 15301-15309  [:1639777]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: