Record in detail


General Info

  • lamp_id:L11A001965
  • Name:Defensin-like protein 4
  • FullName:
  • Source: Raphanus sativus
  • Mass:5676.4 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.21
  • Activity:Fungus
  • Sequence
        XKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1965

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000090    From 31 To 80 E-value: 4e-26 Score: 108
        KLCEKSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
  • 2. L01A002031    From 2 To 51 E-value: 3e-25 Score: 105
        KLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
  • 3. L11A001965    From 2 To 51 E-value: 4e-25 Score: 105
        KLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
  • 4. L02A001687    From 1 To 50 E-value: 5e-25 Score: 104
        KLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYVFPYHRCICYFPC
  • 5. L06AT00032    From 2 To 51 E-value: 7e-25 Score: 104
        KLCEKSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Terras FR, Eggermont K, Kovaleva V, Raikhel nV, Osborn RW, Kester A, Rees SB, Torrekens S, Van Leuve
  •   Title:Small cysteine-rich antifungal proteins from radish: their role in host defense
  •   Journal:Plant Cell, 1995, 7, 573-588  [:7780308]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: