Record in detail


General Info

  • lamp_id:L11A002031
  • Name:mCRAMP, Cathelin-related antimicrobial peptide
  • FullName:
  • Source: Mus musculus
  • Mass:4419.3 Da
  • Sequence Length:39 aa
  • Isoelectric Point:11.25
  • Activity:Gram+Gram-
  • Sequence
        ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  2031

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A002031    From 1 To 39 E-value: 5e-16 Score: 74.7
        ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
  • 2. L01A003119    From 1 To 38 E-value: 0.000000000000002 Score: 72.8
        ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
  • 3. L02A000281    From 1 To 34 E-value: 0.0000000000004 Score: 65.1
        GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
  • 4. L01A003120    From 1 To 33 E-value: 0.000000000001 Score: 63.5
        GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
  • 5. L11A002032    From 1 To 39 E-value: 0.00000000002 Score: 59.3
        ISRLAGLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Travis SM, Anderson nn, Forsyth WR, Espiritu C, Conway BD, Greenberg EP, McCray PB Jr, Lehrer RI, We
  •   Title:Bactericidal activity of mammalian cathelicidin-derived peptides
  •   Journal:Infect Immun, 2000, 68, 2748-2755  [:10768969]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: