Record in detail


General Info

  • lamp_id:L11A002257
  • Name:Cecropin A [V28W]
  • FullName:
  • Source:
  • Mass:4091.9 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.18
  • Activity:ParasiteMammalian Cell
  • Sequence
        KWKLFKKIEKVGQNIRDGIIKAGPAVAWVGQATQIAK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  2257

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A002257    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        KWKLFKKIEKVGQNIRDGIIKAGPAVAWVGQATQIAK
  • 2. L03A000212    From 27 To 63 E-value: 0.000000000000007 Score: 70.9
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
  • 3. L01A000062    From 1 To 37 E-value: 0.00000000000002 Score: 69.7
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
  • 4. L07APD0027    From 1 To 37 E-value: 0.00000000000002 Score: 69.3
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
  • 5. L11A010351    From 1 To 37 E-value: 0.0000000000003 Score: 65.5
        KWKFFKKIERVGQNIRDGIIKAGPAVAVVGQATNIAK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Perez-Cordero JJ, Lozano JM, Cortes J, Delgado G
  •   Title:Leishmanicidal activity of synthetic antimicrobial peptides in an infection model with human dendritic cells
  •   Journal:Peptides, 2011, 32, 683-690  [:21262294]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: