Record in detail


General Info

  • lamp_id:L11A002491
  • Name:Varv He, Varv peptide H
  • FullName:
  • Source: Viola tricolor Viola arvensis
  • Mass:3007.4 Da
  • Sequence Length:30 aa
  • Isoelectric Point:5.93
  • Activity:Cancer
  • Sequence
        GLPVCGETCFGGTCNTPGCSCXTWPVCSRN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  2491

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00217    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        GLPVCGETCFGGTCNTPGCSCETWPVCSRN
  • 2. L11A002491    From 1 To 30 E-value: 0.00000000002 Score: 59.3
        GLPVCGETCFGGTCNTPGCSCXTWPVCSRN
  • 3. L13A022404    From 1 To 30 E-value: 0.00000000009 Score: 57.4
        GLPVCGETCFGGTCNTPGCSCSSWPICTRN
  • 4. L13A011895    From 1 To 30 E-value: 0.00000000009 Score: 57.4
        GLPVCGETCFGGTCNTPGCSCSSWPICTRN
  • 5. L06AT00211    From 1 To 30 E-value: 0.0000000002 Score: 56.6
        GLPVCGETCFGGTCNTPGCSCDPWPMCSRN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tang J, Wang CK, Pan X, Yan H, Zeng G, He W, Daly nL, Craik DJ, Tan n
  •   Title:Isolation and characterization of cytotoxic cyclotides from Viola tricolor
  •   Journal:Peptides, 2010, 31, 1434-1440  [:20580652]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: