Record in detail


General Info

  • lamp_id:L11A002656
  • Name:Bovine hemoglobin alpha chain (34-83)
  • FullName:
  • Source:
  • Mass:5274.9 Da
  • Sequence Length:50 aa
  • Isoelectric Point:6.97
  • Activity:Gram+Gram-
  • Sequence
        LSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGALSEL
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  2656

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A002656    From 1 To 50 E-value: 7e-24 Score: 100
        LSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGALSEL
  • 2. L11A002652    From 1 To 50 E-value: 7e-24 Score: 100
        LSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGALSEL
  • 3. L11A002651    From 2 To 51 E-value: 7e-24 Score: 100
        LSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGALSEL
  • 4. L11A002655    From 2 To 51 E-value: 7e-24 Score: 100
        LSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGALSEL
  • 5. L11A002650    From 2 To 51 E-value: 8e-24 Score: 100
        LSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGALSEL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  nedjar-Arroume n, Dubois-Delval V, Adje EY, Traisnel J, Krier F, Mary P, Kouach M, Briand G, Guilloc
  •   Title:Bovine hemoglobin: an attractive source of antibacterial peptides
  •   Journal:Peptides, 2008, 29, 969¨C977  [:18342399]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: