Record in detail


General Info

  • lamp_id:L11A003170
  • Name:Beta-defensin 8 [V33D][V39D], AvBD8ps-
  • FullName:
  • Source:
  • Mass:4625 Da
  • Sequence Length:41 aa
  • Isoelectric Point:6.48
  • Activity:Gram+Gram-
  • Sequence
        NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGDPCCRTDYD
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  3170

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A003170    From 1 To 41 E-value: 7e-20 Score: 87.8
        NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGDPCCRTDYD
  • 2. L05ADEF297    From 26 To 66 E-value: 1e-19 Score: 86.7
        NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD
  • 3. L11A003168    From 1 To 41 E-value: 2e-18 Score: 82.8
        NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGRPCCRTRYD
  • 4. L01A000524    From 1 To 41 E-value: 2e-18 Score: 82.8
        NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD
  • 5. L11A003169    From 1 To 41 E-value: 8e-17 Score: 77.4
        NNEAQCEQAGGRCSKDHCFHLHTRAFGHCQRGVPCCRRVYD

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Higgs R, Lynn DJ, Cahalane S, Alana I, Hewage CM, James T, Lloyd AT, O'Farrelly C
  •   Title:Modification of chicken avian beta-defensin-8 at positively selected amino acid sites enhances specific antimicrobial activity
  •   Journal:Immunogenetics, 2007, 59, 573-580  [:17483936]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: