Record in detail


General Info

  • lamp_id:L11A004128
  • Name:Lebocin-related peptide 2A, LP2A
  • FullName:
  • Source:
  • Mass:4899.3 Da
  • Sequence Length:43 aa
  • Isoelectric Point:4.43
  • Activity:Gram+Gram-
  • Sequence
        ESGNEPLWLYQGDNIPKAPSTAEHPFLPSIIDDVKFNPDRRYA
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4128

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A004128    From 1 To 43 E-value: 4e-21 Score: 92
        ESGNEPLWLYQGDNIPKAPSTAEHPFLPSIIDDVKFNPDRRYA
  • 2. L11A004127    From 1 To 43 E-value: 4e-21 Score: 91.7
        ESGNEPLWLYQGDNIPKAPSTAEHPFLPSIIDDVKFNPDRRYA
  • 3. L01A000178    From 2 To 42 E-value: 0.00000000000001 Score: 70.5
        ADEPLWLYKGDNIERAPTTADHPILPSIIDDVKLDPNRRYA
  • 4. L04ABAC098    From 11 To 32 E-value: 8.4 Score: 20.8
        VYGGKDLPKGHSHSTMPFLSKL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Rayaprolu S, Wang Y, Kanost MR, Hartson S, Jiang H
  •   Title:Functional analysis of four processing products from multiple precursors encoded by a lebocin-related gene from Manduca sexta
  •   Journal:Dev Comp Immunol, 2010, 34, 638-647  [:20096726]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: