Record in detail


General Info

  • lamp_id:L11A004190
  • Name:Peptide YY
  • FullName:
  • Source: Homo sapiens
  • Mass:4409.9 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.92
  • Activity:FungusMammalian Cell
  • Sequence
        YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4190

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A004190    From 1 To 36 E-value: 9e-16 Score: 73.9
        YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
  • 2. L02A000400    From 1 To 36 E-value: 0.00000000001 Score: 60.5
        YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY
  • 3. L13A020613    From 1 To 36 E-value: 0.000000001 Score: 53.9
        YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY
  • 4. L02A001474    From 1 To 36 E-value: 0.000000002 Score: 53.1
        YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
  • 5. L01A000303    From 1 To 23 E-value: 0.000006 Score: 41.2
        PEEMNKYLTALRHYINLVTRQRY

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Vouldoukis I, Shai Y, nicolas P, Mor A
  •   Title:Broad spectrum antibiotic activity of the skin-PYY
  •   Journal:FEBS Lett, 1996, 380, 237-240  [:8601432]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: