Record in detail


General Info

  • lamp_id:L11A004283
  • Name:Cyclotide chassatide C2
  • FullName:
  • Source: Chassalia chartacea
  • Mass:3308.9 Da
  • Sequence Length:31 aa
  • Isoelectric Point:5.93
  • Activity:Gram+Gram-CancerMammalian Cell
  • Sequence
        GIPCAESCVWIPCTITALMGCSCKNNVCYNN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4283

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06260|    From 45 To 75 E-value: 0.00000000000005 Score: 68.2
        GIPCAESCVWIPCTITALMGCSCKNNVCYNN
  • 2. L11A004283    From 1 To 31 E-value: 0.0000000000006 Score: 64.7
        GIPCAESCVWIPCTITALMGCSCKNNVCYNN
  • 3. L11A004284    From 1 To 31 E-value: 0.000000000003 Score: 62
        GIPCAESCVWIPCTITALXGCSCKNNVCYNN
  • 4. L12A06268|    From 45 To 75 E-value: 0.000000000005 Score: 61.6
        GIPCAESCVYIPCTITALFGCSCKDKVCYNN
  • 5. L12A06269|    From 45 To 75 E-value: 0.000000000007 Score: 60.8
        GVPCAESCVYIPCTITALFGCSCKDKVCYNN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  nguyen GK, Lim WH, nguyen PQ, Tam JP
  •   Title:novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities
  •   Journal:J Biol Chem, 2012, 287, 17598-17607  [:22467870]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: