Record in detail


General Info

  • lamp_id:L11A004296
  • Name:Saposin-like protein SPP-12
  • FullName:
  • Source:
  • Mass:8681.7 Da
  • Sequence Length:78 aa
  • Isoelectric Point:4.21
  • Activity:Gram+Gram-CancerFungusProtista
  • Sequence
        GSHGAFCHLCEDLIKDGKEAGDVALDVWLDEEIGSRCKDFGVLASECFKELKVAEHDIWEAIDQEIPEDKTCKEAKLC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4296

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A004296    From 1 To 78 E-value: 5e-40 Score: 154
        GSHGAFCHLCEDLIKDGKEAGDVALDVWLDEEIGSRCKDFGVLASECFKELKVAEHDIWEAIDQEIPEDKTCKEAKLC
  • 2. L12A01605|    From 1 To 73 E-value: 7e-37 Score: 144
        FCHLCEDLIKDGKEAGDVALDVWLDEEIGSRCKDFGVLASECFKELKVAEHDIWEAIDQEIPEDKTCKEAKLC
  • 3. L13A013541    From 12 To 46 E-value: 0.00001 Score: 40.4
        HGVFCDVCKALVEGGEKVGDDDLDAWLDVNIGTLC
  • 4. L12A09772|    From 12 To 46 E-value: 0.00001 Score: 40.4
        HGVFCDVCKALVEGGEKVGDDDLDAWLDVNIGTLC
  • 5. L11A004295    From 13 To 89 E-value: 0.00001 Score: 40
        HGVFCDVCKALVEGGEKVGDDDLDAWLDVNIGTLCWTMLLPLHHECEEELKKVKKELKKDIENKDSPDKACKDVDLC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hoeckendorf A, Stanisak M, Leippe M
  •   Title:The saposin-like protein SPP-12 is an antimicrobial polypeptide in the pharyngeal neurons of Caenorhabditis elegans and participates in defence against a natural bacterial pathogen
  •   Journal:Biochem J, 2012, 445, 205-212  [:22519640]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: