Record in detail


General Info

  • lamp_id:L11A004351
  • Name:Lingual antimicrobial peptide
  • FullName:
  • Source: Bos taurus Bos mutus Bubalus bubalis
  • Mass:4649.5 Da
  • Sequence Length:42 aa
  • Isoelectric Point:11.44
  • Activity:Gram+Gram-Fungus
  • Sequence
        QGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4351

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001371    From 23 To 64 E-value: 3e-19 Score: 85.5
        QGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 2. L01A001519    From 3 To 44 E-value: 1e-18 Score: 83.2
        QGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 3. L02A000401    From 4 To 45 E-value: 2e-18 Score: 83.2
        QGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 4. L11A004351    From 1 To 42 E-value: 2e-18 Score: 82.8
        QGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 5. L13A025863    From 1 To 41 E-value: 7e-18 Score: 80.9
        GVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Schonwetter BS, Stolzenberg ED, Zasloff M
  •   Title:Epithelial antibiotics induced at sites of inflammation
  •   Journal:Science, 1995, 267(5204), 1645-1648  [:7886453]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: