Record in detail
General Info
- lamp_id:L11A004535
- Name:Plectasin-derived peptide NZ2114
- FullName:
- Source:
- Mass:4417 Da
- Sequence Length:40 aa
- Isoelectric Point:8.38
- Activity:Gram+Mammalian Cell
- Sequence
GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY - Function:
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 4535
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A08934| From 56 To 95 E-value: 4e-19 Score: 85.1
GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY - 2. L13A011186 From 3 To 42 E-value: 1e-18 Score: 83.6
GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY - 3. L11A004535 From 1 To 40 E-value: 1e-18 Score: 83.6
GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY - 4. L01A003049 From 1 To 40 E-value: 1e-17 Score: 80.1
GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY - 5. L11A012115 From 1 To 40 E-value: 2e-17 Score: 79.7
GFGCNGPWSEDDLRCHRHCKSIKGYRGGYCAKGGFVCKCY
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Zhang Y, Teng D, Mao R, Wang X, Xi D, Hu X, Wang J
- Title:High expression of a plectasin-derived peptide nZ2114 in Pichia pastoris and its pharmacodynamics, postantibiotic and synergy against Staphylococcus aureus
- Journal:Appl Microbiol Biotechnol, 2014, 98, 681-694 [:23624708]
- [2] Zong L, Teng D, Wang X, Mao R, Yang n, Hao Y, Wang J
- Title:Mechanism of action of a novel recombinant peptide, MP1102, against Clostridium perfringens type C
- Journal:Appl Microbiol Biotechnol, 2016 [:26921181]
Comments
- Comments
No comments found on LAMP database