Record in detail


General Info

  • lamp_id:L11A004535
  • Name:Plectasin-derived peptide NZ2114
  • FullName:
  • Source:
  • Mass:4417 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.38
  • Activity:Gram+Mammalian Cell
  • Sequence
        GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4535

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08934|    From 56 To 95 E-value: 4e-19 Score: 85.1
        GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 2. L13A011186    From 3 To 42 E-value: 1e-18 Score: 83.6
        GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 3. L11A004535    From 1 To 40 E-value: 1e-18 Score: 83.6
        GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 4. L01A003049    From 1 To 40 E-value: 1e-17 Score: 80.1
        GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 5. L11A012115    From 1 To 40 E-value: 2e-17 Score: 79.7
        GFGCNGPWSEDDLRCHRHCKSIKGYRGGYCAKGGFVCKCY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang Y, Teng D, Mao R, Wang X, Xi D, Hu X, Wang J
  •   Title:High expression of a plectasin-derived peptide nZ2114 in Pichia pastoris and its pharmacodynamics, postantibiotic and synergy against Staphylococcus aureus
  •   Journal:Appl Microbiol Biotechnol, 2014, 98, 681-694  [:23624708]
  •   [2]  Zong L, Teng D, Wang X, Mao R, Yang n, Hao Y, Wang J
  •   Title:Mechanism of action of a novel recombinant peptide, MP1102, against Clostridium perfringens type C
  •   Journal:Appl Microbiol Biotechnol, 2016  [:26921181]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: