Record in detail


General Info

  • lamp_id:L11A004937
  • Name:Styelin-D
  • FullName:
  • Source: Styela clava
  • Mass:2732 Da
  • Sequence Length:32 aa
  • Isoelectric Point:9.69
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        GXLXXAAXSVGXFXXXHXXXIXAAWQIGKHAL
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4937

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08954|    From 23 To 54 E-value: 0.00003 Score: 39.3
        GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL
  • 2. L01A000525    From 1 To 32 E-value: 0.00004 Score: 38.9
        GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL
  • 3. L13A025503    From 1 To 31 E-value: 0.0001 Score: 37
        GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHA
  • 4. L02A000331    From 1 To 32 E-value: 0.0002 Score: 36.6
        GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHAL
  • 5. L01A003107    From 1 To 32 E-value: 0.0002 Score: 36.2
        GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHAL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Taylor SW, Craig AG, Fischer WH, Park M, Lehrer RI
  •   Title:Styelin D, an extensively modified antimicrobial peptide from ascidian hemocytes
  •   Journal:J Biol Chem, 2000, 275, 38417-38426  [:10978343]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: