Record in detail


General Info

  • lamp_id:L11A005013
  • Name:FALL-39 [Q24K]
  • FullName:
  • Source:
  • Mass:4745.6 Da
  • Sequence Length:39 aa
  • Isoelectric Point:11.41
  • Activity:Gram-
  • Sequence
        FALLGDFFRKSKEKIGKEFKRIVKRIKDFFRNLVPRTES
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  5013

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A005013    From 1 To 39 E-value: 2e-16 Score: 76.3
        FALLGDFFRKSKEKIGKEFKRIVKRIKDFFRNLVPRTES
  • 2. L11A005007    From 1 To 39 E-value: 3e-16 Score: 75.5
        FALLGDFFRKSKEKIGKEFKRIVQRIKDFFRNLVPRTES
  • 3. L12A11486|    From 20 To 58 E-value: 7e-16 Score: 74.3
        FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 4. L01A003954    From 1 To 39 E-value: 0.000000000000001 Score: 73.9
        FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 5. L11A005011    From 1 To 39 E-value: 0.000000000000002 Score: 72.8
        FALLGDFFRKSKEKIGKEFKRIVQRIKDFFRKLVPRTES

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yang YX, Feng Y, Wang BY, Wu Q
  •   Title:PCR-based site-specific mutagenesis of peptide antibiotics FALL-39 and its biologic activities
  •   Journal:Acta Pharmacol Sin, 2004, 25, 239-245  [:14769216]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: