Record in detail


General Info

  • lamp_id:L11A005547
  • Name:Bullfrog Buforin I
  • FullName:
  • Source: Lithobates catesbeiana (Rana catesbeiana) Xenopus tropicalis Bufo gargarizans Ornithorhynchus anatinus
  • Mass:4279 Da
  • Sequence Length:39 aa
  • Isoelectric Point:12.91
  • Activity:Gram+Gram-FungusMammalian Cell
  • Sequence
        SGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  5547

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A005547    From 1 To 39 E-value: 2e-16 Score: 76.3
        SGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
  • 2. L01A000300    From 1 To 39 E-value: 4e-16 Score: 75.5
        AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
  • 3. L12A09319|    From 2 To 40 E-value: 0.000000000000002 Score: 72.8
        SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNY
  • 4. L12A11014|    From 1 To 39 E-value: 0.000000000000002 Score: 72.8
        SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNY
  • 5. L12A11012|    From 1 To 39 E-value: 0.000000000000002 Score: 72.8
        SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Minn I, Kim HS, Kim SC
  •   Title:Antimicrobial peptides derived from pepsinogens in the stomach of the bullfrog, Rana catesbeiana
  •   Journal:Biochim Biophys Acta, 1998, 1407, 31-39  [:9639668]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: