Record in detail


General Info

  • lamp_id:L11A005817
  • Name:Male-specific defensin, HIMS-Defensin
  • FullName:
  • Source: Haemaphysalis longicornis
  • Mass:5510.6 Da
  • Sequence Length:48 aa
  • Isoelectric Point:8.88
  • Activity:Gram+Gram-Fungus
  • Sequence
        DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTHIPIRRPPFIMG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  5817

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A005817    From 1 To 48 E-value: 3e-23 Score: 99
        DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTHIPIRRPPFIMG
  • 2. L02A001815    From 1 To 48 E-value: 3e-22 Score: 95.5
        DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTMIPIRRPPFIMG
  • 3. L12A06166|    From 32 To 78 E-value: 1e-17 Score: 80.1
        DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPL-RPPFMVG
  • 4. L02A001554    From 1 To 47 E-value: 8e-17 Score: 77.4
        DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPL-RPPFMVG
  • 5. L13A014749    From 1 To 46 E-value: 5e-16 Score: 74.7
        FGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPL-RPPFMVG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zheng H, Zhou L, Yang X, Wang D, Liu J
  •   Title:Cloning and characterization of a male-specific defensin-like antimicrobial peptide from the tick Haemaphysalis longicornis
  •   Journal:Dev Comp Immunol, 2012, 37, 207-211  [:22033149]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: