Record in detail


General Info

  • lamp_id:L11A005857
  • Name:Beta-defensin 103 (6-45), hBD-3
  • FullName:
  • Source:
  • Mass:4662.6 Da
  • Sequence Length:40 aa
  • Isoelectric Point:10.63
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        LQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  5857

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000247    From 28 To 67 E-value: 1e-17 Score: 80.5
        LQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 2. L03A000252    From 28 To 67 E-value: 1e-17 Score: 80.5
        LQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 3. L01A000701    From 6 To 45 E-value: 3e-17 Score: 79
        LQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 4. L11A007910    From 3 To 42 E-value: 3e-17 Score: 79
        LQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 5. L11A005857    From 1 To 40 E-value: 4e-17 Score: 78.2
        LQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Schulz A, Kl¨¹ver E, Schulz-Maronde S, Adermann K
  •   Title:Engineering disulfide bonds of the novel human beta-defensins hBD-27 and hBD-28: differences in disulfide formation and biological activity among human beta-defensins
  •   Journal:Biopolymers, 2005, 80, 34-49  [:15625724]
  •   [2]  Kl¨¹ver E, Schulz-Maronde S, Scheid S, Meyer B, Forssmann WG, Adermann K
  •   Title:Structure-activity relation of human beta-defensin 3: influence of disulfide bonds and cysteine substitution on antimicrobial activity and cytotoxicity
  •   Journal:Biochemistry, 2005, 44, 9804-9816  [:16008365]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: