Record in detail


General Info

  • lamp_id:L11A005878
  • Name:Recombinant Vr defensin 1, rVrD1
  • FullName:
  • Source:
  • Mass:4939.8 Da
  • Sequence Length:44 aa
  • Isoelectric Point:8.4
  • Activity:Fungus
  • Sequence
        YVRTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKTCYCLVNC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  5878

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A005878    From 1 To 44 E-value: 9e-21 Score: 90.5
        YVRTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKTCYCLVNC
  • 2. L03A000114    From 27 To 73 E-value: 5e-18 Score: 81.6
        ARTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 3. L02A000989    From 1 To 46 E-value: 7e-18 Score: 80.9
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKGMTRTCYCLVNC
  • 4. L01A002676    From 1 To 46 E-value: 2e-17 Score: 79.3
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 5. L02A000715    From 1 To 45 E-value: 0.000000000000002 Score: 73.2
        RTCM-KKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chen JJ, Chen GH, Hsu HC, Li SS, Chen CS
  •   Title:Cloning and functional expression of a mungbean defensin VrD1 in Pichia pastoris
  •   Journal:J Agric Food Chem, 2004, 52, 2256-2261  [:15080630]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: