Record in detail


General Info

  • lamp_id:L11A006041
  • Name:LFcin (17-30) + K + Retro LFcin (265-284), LFchimera
  • FullName:
  • Source:
  • Mass:4423.3 Da
  • Sequence Length:35 aa
  • Isoelectric Point:11.85
  • Activity:Gram+Gram-
  • Sequence
        FKCRRWQWRMKKLGKRSKNKGFKEQAKSLLKWILD
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6041

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A006041    From 1 To 35 E-value: 0.00000000000002 Score: 69.7
        FKCRRWQWRMKKLGKRSKNKGFKEQAKSLLKWILD
  • 2. L12A03254|    From 22 To 38 E-value: 0.0007 Score: 34.3
        FKCRRWQWRMKKLGAPS
  • 3. L03A000018    From 1 To 17 E-value: 0.0007 Score: 34.3
        FKCRRWQWRMKKLGAPS
  • 4. L12A05621|    From 21 To 37 E-value: 0.0007 Score: 34.3
        FKCRRWQWRMKKLGAPS
  • 5. L07APD0091    From 22 To 38 E-value: 0.0008 Score: 34.3
        FKCRRWQWRMKKLGAPS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bolscher JG, Adao R, nazmi K, van den Keybus PA, van 't Hof W, nieuw Amerongen AV, Bastos M, Veerman
  •   Title:Bactericidal activity of LFchimera is stronger and less sensitive to ionic strength than its constituent lactoferricin and lactoferrampin peptides
  •   Journal:Biochimie, 2009, 91, 123-132  [:18573310]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: