Record in detail


General Info

  • lamp_id:L11A006084
  • Name:Beta-defensin 103 [C11,18,23,33,41A], HDB3 [C11,18,23,33,41A]
  • FullName:
  • Source:
  • Mass:5000.9 Da
  • Sequence Length:45 aa
  • Isoelectric Point:11.92
  • Activity:Gram+Gram-Fungus
  • Sequence
        GIINTLQKYYARVRGGRAAVLSALPKEEQIGKASTRGRKCARRKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6084

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A006084    From 1 To 45 E-value: 2e-20 Score: 89
        GIINTLQKYYARVRGGRAAVLSALPKEEQIGKASTRGRKCARRKK
  • 2. L13A020214    From 1 To 45 E-value: 2e-19 Score: 86.3
        GIINTLQKYYARVRGGRAAVLSALPKEEQIGKASTRGRKAARRKK
  • 3. L01A000701    From 1 To 45 E-value: 1e-18 Score: 83.6
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 4. L03A000252    From 23 To 67 E-value: 1e-18 Score: 83.2
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 5. L03A000247    From 23 To 67 E-value: 1e-18 Score: 83.2
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Taylor K, Clarke DJ, McCullough B, Chin W, Seo E, Yang D, Oppenheim J, Uhrin D, Govan JR, Campopiano
  •   Title:Analysis and separation of residues important for the chemoattractant and antimicrobial activities of beta-defensin 3
  •   Journal:J Biol Chem, 2008, 283, 6631-6639  [:18180295]
  •   [2]  Caiaffa KS, Massunari L, Danelon M, Abuna GF, Bedran TBL, Santos-Filho nA, Spolidorio DMP, Vizoto nL
  •   Title:KR-12-a5 is a non-cytotoxic agent with potent antimicrobial effects against oral pathogens
  •   Journal:Biofouling, 2017  [:29022391]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: