Record in detail


General Info

  • lamp_id:L11A006085
  • Name:Beta-defensin 14 [C11,18,23,33,40,41A], Defb14 [C11,18,23,33,40,41A]
  • FullName:
  • Source:
  • Mass:4997.9 Da
  • Sequence Length:45 aa
  • Isoelectric Point:12.65
  • Activity:Gram+Gram-
  • Sequence
        FLPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKAARKKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6085

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A006085    From 1 To 45 E-value: 1e-19 Score: 86.7
        FLPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKAARKKK
  • 2. L11A000053    From 1 To 45 E-value: 3e-19 Score: 85.5
        FLPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • 3. L11A001150    From 1 To 44 E-value: 2e-18 Score: 83.2
        LPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • 4. L01A002474    From 1 To 45 E-value: 2e-18 Score: 82.8
        FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK
  • 5. L11A001152    From 1 To 43 E-value: 5e-18 Score: 81.3
        PKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Taylor K, Clarke DJ, McCullough B, Chin W, Seo E, Yang D, Oppenheim J, Uhrin D, Govan JR, Campopiano
  •   Title:Analysis and separation of residues important for the chemoattractant and antimicrobial activities of beta-defensin 3
  •   Journal:J Biol Chem, 2008, 283, 6631-6639  [:18180295]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: