Record in detail


General Info

  • lamp_id:L11A006392
  • Name:
  • FullName:
  • Source:
  • Mass:5384.4 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.57
  • Activity:Virus
  • Sequence
        RMKQIEDKIEEIESKPKKIENEIARIKKLLQLTVWGPKQLQARIL
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6392

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A006392    From 1 To 45 E-value: 1e-19 Score: 86.7
        RMKQIEDKIEEIESKPKKIENEIARIKKLLQLTVWGPKQLQARIL
  • 2. L13A013147    From 1 To 45 E-value: 1e-17 Score: 80.1
        RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
  • 3. L11A006404    From 1 To 45 E-value: 2e-17 Score: 79.7
        RMKQIEDKIEEIESKIKKIENEIARIKKLLQLTVWGIKQLQARIL
  • 4. L11A006393    From 1 To 45 E-value: 8e-17 Score: 77.4
        RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWDIKQLQARIL
  • 5. L11A006394    From 1 To 52 E-value: 0.000000000000001 Score: 73.6
        RMKQIEDKIEEIESKQKKIENEIARIKKLIEAQQHLLQLTVWGIKQLQARIL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Eckert DM, Kim PS
  •   Title:Design of potent inhibitors of HIV-1 entry from the gp41 n-peptide region
  •   Journal:Proc natl Acad Sci U S A, 2001, 98, 11187-11192  [:11572974]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: