Record in detail


General Info

  • lamp_id:L11A006415
  • Name:Cathelicidin (150-185), asCATH2
  • FullName:
  • Source:
  • Mass:3633 Da
  • Sequence Length:36 aa
  • Isoelectric Point:12.81
  • Activity:Gram-Mammalian Cell
  • Sequence
        RRGKPSGGSRGSKMGSKDSKGGWRGRPGSGSRPGFG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6415

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A006415    From 1 To 36 E-value: 0.000000000001 Score: 63.5
        RRGKPSGGSRGSKMGSKDSKGGWRGRPGSGSRPGFG
  • 2. L12A10661|    From 1 To 33 E-value: 0.00000008 Score: 47.4
        RRGKDSGGP---KMGRKDSKGCWRGRPGSGSRPGFG
  • 3. L13A027314    From 1 To 33 E-value: 0.0000002 Score: 46.6
        RRGKDSGGP---KMGRKDSKGCWRGRPGSGSRPGFG
  • 4. L12A10129|    From 6 To 25 E-value: 0.026 Score: 29.3
        RRSKARGGSRGSKMGRKDSK
  • 5. L12A10731|    From 1 To 20 E-value: 0.032 Score: 28.9
        RRSKARGGSRGSKMGRKDSK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bridle A, nosworthy E, Polinski M, nowak B
  •   Title:Evidence of an antimicrobial-immunomodulatory role of Atlantic salmon cathelicidins during infection with Yersinia ruckeri
  •   Journal:PLoS One, 2011, 6, e23417  [:21858109]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: