Record in detail


General Info

  • lamp_id:L11A006435
  • Name:Hemoglobin subunit alpha (106-141)
  • FullName:
  • Source:
  • Mass:3900.4 Da
  • Sequence Length:36 aa
  • Isoelectric Point:9.26
  • Activity:Gram+Gram-
  • Sequence
        LVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6435

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A006435    From 1 To 36 E-value: 0.000000000000004 Score: 72
        LVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
  • 2. L13A020007    From 1 To 35 E-value: 0.00000000000001 Score: 70.5
        VTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
  • 3. L11A006430    From 1 To 32 E-value: 0.0000000000003 Score: 65.9
        ASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
  • 4. L13A025197    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        VTLASHLPSDFTPAVHASLDKFLANVSTVL
  • 5. L11A002687    From 1 To 27 E-value: 0.0000000005 Score: 55.1
        VTLASHLPSDFTPAVHASLDKFLANVS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Adje EY, Balti R, Kouach M, Dhulster P, Guillochon D, nedjar-Arroume n
  •   Title:Obtaining antimicrobial peptides by controlled peptic hydrolysis of bovine hemoglobin
  •   Journal:Int J Biol Macromol, 2011, 49, 143-153  [:21510973]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: