Record in detail


General Info

  • lamp_id:L11A006505
  • Name:Smapspin-G, SMAP-29 + 4GS + Spinigerin
  • FullName:
  • Source:
  • Mass:6554 Da
  • Sequence Length:59 aa
  • Isoelectric Point:12.62
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        RGLRRLGRKIAHGVKKYGPTVLRIIRIAGGGGGSHVDKKVADKVLLLKQLRIMRLLTRL
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6505

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A006505    From 1 To 59 E-value: 2e-26 Score: 109
        RGLRRLGRKIAHGVKKYGPTVLRIIRIAGGGGGSHVDKKVADKVLLLKQLRIMRLLTRL
  • 2. L11A006503    From 1 To 57 E-value: 5e-22 Score: 94.7
        RGLRRLGRKIAHGVKKYGPTVLRIIRIA--GEKRHVDKKVADKVLLLKQLRIMRLLTRL
  • 3. L11A006530    From 1 To 29 E-value: 0.0000000001 Score: 57
        RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
  • 4. L01A001008    From 1 To 29 E-value: 0.0000000002 Score: 56.2
        RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
  • 5. L11A006526    From 1 To 29 E-value: 0.0000000004 Score: 55.1
        RGLRRLGKKIAHGVKKYGPTVLRIIRIAG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dawson RM, Fox MA, Atkins HS, Liu CQ
  •   Title:Potent antimicrobial peptides with selectivity for Bacillus anthracis over human erythrocytes
  •   Journal:Int J Antimicrob Agents, 2011, 38, 237-242  [:21741801]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: