Record in detail


General Info

  • lamp_id:L11A006530
  • Name:SMAP-29 + Pep-1-K
  • FullName:
  • Source:
  • Mass:6083.4 Da
  • Sequence Length:50 aa
  • Isoelectric Point:12.93
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        RGLRRLGRKIAHGVKKYGPTVLRIIRIAGKKTWWKTWWTKWSQPKKKRKV
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6530

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A006530    From 1 To 50 E-value: 5e-22 Score: 94.7
        RGLRRLGRKIAHGVKKYGPTVLRIIRIAGKKTWWKTWWTKWSQPKKKRKV
  • 2. L11A006503    From 1 To 31 E-value: 0.000000000007 Score: 60.8
        RGLRRLGRKIAHGVKKYGPTVLRIIRIAGEK
  • 3. L01A001008    From 1 To 29 E-value: 0.00000000007 Score: 57.8
        RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
  • 4. L11A006505    From 1 To 28 E-value: 0.0000000001 Score: 57.4
        RGLRRLGRKIAHGVKKYGPTVLRIIRIA
  • 5. L11A006526    From 1 To 29 E-value: 0.0000000002 Score: 56.6
        RGLRRLGKKIAHGVKKYGPTVLRIIRIAG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dawson RM, Liu CQ
  •   Title:Analogues of peptide SMAP-29 with comparable antimicrobial potency and reduced cytotoxicity
  •   Journal:Int J Antimicrob Agents, 2011, 37, 432-437  [:21377841]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: