Record in detail


General Info

  • lamp_id:L11A006916
  • Name:Beta-defensin 103 (6-45) [C11,13,18,28,35,36A]
  • FullName:
  • Source:
  • Mass:4470.2 Da
  • Sequence Length:40 aa
  • Isoelectric Point:12.18
  • Activity:Gram+Gram-
  • Sequence
        LQKYYARVRGGRAAVLSALPKEEQIGKASTRGRKAARRKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6916

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A020214    From 6 To 45 E-value: 1e-16 Score: 76.6
        LQKYYARVRGGRAAVLSALPKEEQIGKASTRGRKAARRKK
  • 2. L11A006916    From 1 To 40 E-value: 2e-16 Score: 76.3
        LQKYYARVRGGRAAVLSALPKEEQIGKASTRGRKAARRKK
  • 3. L11A006084    From 6 To 45 E-value: 3e-16 Score: 75.5
        LQKYYARVRGGRAAVLSALPKEEQIGKASTRGRKCARRKK
  • 4. L11A007910    From 3 To 42 E-value: 0.000000000000002 Score: 72.8
        LQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 5. L01A000701    From 6 To 45 E-value: 0.000000000000002 Score: 72.8
        LQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kl¨¹ver E, Schulz-Maronde S, Scheid S, Meyer B, Forssmann WG, Adermann K
  •   Title:Structure-activity relation of human beta-defensin 3: influence of disulfide bonds and cysteine substitution on antimicrobial activity and cytotoxicity
  •   Journal:Biochemistry, 2005, 44, 9804-9816  [:16008365]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: