Record in detail


General Info

  • lamp_id:L11A007234
  • Name:Bactericidal permeability-increasing protein (65-99)
  • FullName:
  • Source:
  • Mass:4063.8 Da
  • Sequence Length:35 aa
  • Isoelectric Point:11.75
  • Activity:Gram+Gram-
  • Sequence
        NSQIRPLPDKGLDLSIRDASIKIRGKWKARKNFIK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  7234

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A007234    From 1 To 35 E-value: 0.000000000000009 Score: 70.5
        NSQIRPLPDKGLDLSIRDASIKIRGKWKARKNFIK
  • 2. L01A001403    From 1 To 15 E-value: 0.34 Score: 25.4
        IKISGKWKAQKRFLK
  • 3. L11A007236    From 1 To 10 E-value: 1.4 Score: 23.5
        KWKARKNFIK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chockalingam A, Zarlenga DS, Bannerman DD
  •   Title:Antimicrobial activity of bovine bactericidal permeability-increasing protein-derived peptides against gram-negative bacteria isolated from the milk of cows with clinical mastitis
  •   Journal:Am J Vet Res, 2007, 68, 1151-1159  [:17975968]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: