Record in detail


General Info

  • lamp_id:L11A007841
  • Name:LL-37 [S9V]
  • FullName:
  • Source:
  • Mass:4505.3 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.35
  • Activity:Gram-
  • Sequence
        LLGDFFRKVKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  7841
  •   2  Database:DRAMP  DRAMP04015

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A007841    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        LLGDFFRKVKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 2. L12A11486|    From 22 To 58 E-value: 0.000000000000004 Score: 72
        [LL-37, 37 aa]
  • 3. L11A011557    From 1 To 37 E-value: 0.000000000000004 Score: 72
        [LL-37, 37 aa]
  • 4. L11A007840    From 1 To 37 E-value: 0.000000000000004 Score: 72
        LLGDFFRKAKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 5. L02A000624    From 2 To 38 E-value: 0.000000000000005 Score: 71.2
        [LL-37, 37 aa]

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wang G, Elliott M, Cogen AL, Ezell EL, Gallo RL, Hancock RE
  •   Title:Structure, dynamics, and antimicrobial and immune modulatory activities of human LL-23 and its single-residue variants mutated on the basis of homologous primate cathelicidins
  •   Journal:Biochemistry, 2012, 51, 653-664  [:22185690]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: