Record in detail


General Info

  • lamp_id:L11A007998
  • Name:Centrocin 2 heavy chain, Centrocin 2 (51-80)
  • FullName:
  • Source:
  • Mass:2979.4 Da
  • Sequence Length:30 aa
  • Isoelectric Point:11.48
  • Activity:Antibacterial
  • Sequence
        SXFSRTVHNVGNAVRKGIHAGQGVCSGLGL
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  7998

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001574    From 1 To 30 E-value: 0.00000000003 Score: 58.9
        SWFSRTVHNVGNAVRKGIHAGQGVCSGLGL
  • 2. L11A007998    From 1 To 30 E-value: 0.00000000004 Score: 58.5
        SXFSRTVHNVGNAVRKGIHAGQGVCSGLGL
  • 3. L13A024666    From 1 To 29 E-value: 0.0000000001 Score: 57
        SWFSRTVHNVGNAVRKGIHAGQGVCSGLG
  • 4. L02A001573    From 3 To 30 E-value: 0.0003 Score: 35.8
        FKKTFHKVSHAVKSGIHAGQRGCSALGF
  • 5. L11A007994    From 3 To 30 E-value: 0.0003 Score: 35.8
        FKKTFHKVSHAVKSGIHAGQRGCSALGF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: