Record in detail


General Info

  • lamp_id:L11A008301
  • Name:Defensin MT5
  • FullName:
  • Source: Ixodes ricinus
  • Mass:4533.4 Da
  • Sequence Length:38 aa
  • Isoelectric Point:9.82
  • Activity:Gram+Gram-ParasiteFungus
  • Sequence
        GFFCPYNGYCDRHCRKKLRRRGGYCGGRWKLTCICIMN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  8301

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A008301    From 1 To 38 E-value: 2e-17 Score: 79.7
        GFFCPYNGYCDRHCRKKLRRRGGYCGGRWKLTCICIMN
  • 2. L12A04410|    From 1 To 36 E-value: 0.00000000000003 Score: 68.9
        GYFCPYNGYCDHHCRKKLRWRGGYCGGRWKLTCICV
  • 3. L05ADEF502    From 1 To 37 E-value: 0.000000001 Score: 53.5
        GFFCPYNGYCDRHCRKKLRRRGGYCGGRWKLTCICVQ
  • 4. L12A02512|    From 1 To 37 E-value: 0.000000009 Score: 50.8
        GFFCPYNGYCDR-CRKKLRRRGGYCGGRWKLTCICIMN
  • 5. L11A010719    From 1 To 36 E-value: 0.000002 Score: 42.7
        GFGCPFNARRCHRHCRS-IRRRAGYCAGRLRLTCTCV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tonk M, Cabezas-Cruz A, Valdes JJ, Rego RO, Grubhoffer L, Estrada-Pena A, Vilcinskas A, Kotsyfakis M
  •   Title:Ixodes ricinus defensins attack distantly-related pathogens
  •   Journal:Dev Comp Immunol, 2015, 53, 358-365  [:26255244]
  •   [2]  Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A,
  •   Title:Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins
  •   Journal:Front Microbiol, 2016, 7, 1682  [:27822206]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: