Record in detail


General Info

  • lamp_id:L11A008375
  • Name:Alpha-S1-casein (1-36)
  • FullName:
  • Source:
  • Mass:4241 Da
  • Sequence Length:36 aa
  • Isoelectric Point:10.33
  • Activity:Gram+Gram-
  • Sequence
        RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  8375

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A008376    From 1 To 36 E-value: 0.000000000000001 Score: 73.6
        RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEK
  • 2. L11A008375    From 1 To 36 E-value: 0.000000000000001 Score: 73.6
        RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEK
  • 3. L11A008371    From 1 To 34 E-value: 0.00000000000001 Score: 70.1
        RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGK
  • 4. L11A008370    From 1 To 24 E-value: 0.000000006 Score: 51.2
        RPKHPIKHQGLPQEVLNENLLRFF
  • 5. L02A001400    From 1 To 23 E-value: 0.00000003 Score: 49.3
        RPKHPIKHQGLPQEVLNENLLRF

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Liu Y, Eichler J, Pischetsrieder M
  •   Title:Virtual screening of a milk peptide database for the identification of food-derived antimicrobial peptides
  •   Journal:Mol nutr Food Res, 2015  [:26202586]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: